Mini Cart

IGF-I, Swine

96.00 USD475.20 USD

volume

Clear
SKU: C03017 Category: Tags: ,

Description

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

Sequence: 
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear