Menu

Mini Cart

TWEAK, Mouse

96.00 USD475.20 USD

volume

Clear
SKU: C02050 Category: Tags: ,

Description

TWEAK belongs to the TNF family of ligands, and also known as TNFRSF12A through TWEAK receptor signaling. TWEAK wildly expresses in a variety of tissues, including the adult heart, pancreas, skeletal muscle, small intestine, spleen and peripheral blood lymphocytes. TWEAK has the ability to trigger activation and chemokine secretion of NF-κB, and to apply an apoptotic activity in certain cells, such as HT-29 human cultured adenocarcinoma cells feeding with IFN-γ. TWEAK also promotes proliferation and migration of endothelial cells.

Sequence: 
MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLV
NGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear