Mini Cart

IL-7, Mouse

96.00 USD475.20 USD


SKU: C02009 Category: Tags: ,


Interleukin 7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis.

TSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus

Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.

>98% as determined by SDS-PAGE. Ni-NTA chromatography

The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Please use within one month after protein reconstitution.

Additional information


5 μg, 20 μg, 100 µg

