Menu

Mini Cart

IFN beta 1a, Mouse

96.00 USD475.20 USD

volume

Clear
SKU: C02054 Category: Tags: ,

Description

Interferon-beta is, a cytokine, released by fibroblasts and pathogen-exposed dendritic cells, macrophages, and endothelial cells. IFN beta 1a conducts through the heterodimeric IFN-alpha/beta Receptor. IFN-beta-deficient mice are easier to suffer from experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS).In addition, IFN-beta has been proved to suppress the Th17 cell response in both MS and EAE and is usually used to treat MS disease.

Sequence: 
MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNFSSTGWNETIVVRLLDELHQQTVF
LKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to protect HeLa cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 pg/mL. The specific activity of recombinant mouse IFN beta 1a is > 1 x 109 IU/mg.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.

Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear