Mini Cart

HDGF, Mouse

96.00 USD475.20 USD

volume

Clear
SKU: C02070 Category: Tags: ,

Description

HDGF is a member of the hepatoma-derived growth factor family. HDGF plays a role as a secreted mitogen from the human hepatoma cell line Huh-7. HDGF is a nuclear targeted vascular smooth muscle cell mitogen as well as a heparin-binding protein that is greatly expressed in tumor cells where it stimulates proliferation. HDGF has several biochemical functions, for example, DNA binding, RNA polymerase II transcription corepressor activity, growth factor activity. Some of the functions are cooperated with other proteins, some of the functions could acted by HDGF itself.

Sequence: 
MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIEN
NPTVKASGYQSSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEI
AALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear