Mini Cart

IL-36RA, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01044 Category: Tags: , ,

Description

As a result of the interaction of IL-36 ligands with the IL-1Rrp2 receptor. Various activities including dendritic cell maturation and activation are induced. IL-36RA can antagonize the NF-κB signaling through binding to the IL-1Rrp2 receptor by either IL-36α, β or γ in a way of preventing the initiation of functional signaling.

Sequence: 
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGA
KESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED50 for this effect is <2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear