Menu

Mini Cart

IL-32 alpha, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01038 Category: Tags: , ,

Description

Interleukin-32α (IL-32 α) is one of approximately 6 splice variants of a gene cloned from the human lung carcinoma stable transfectant, A549-Rβ. IL-32 α has been shown to induce IL-8, TNF-α, and MIP-2 production from human & mouse macrophage cell lines. It is up-regulated in activated T- & NK-cells, and IFN-g-treated epithelial cells.

Sequence: 
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPD
VEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce TNF alpha secretion in RAW264.7 cells. The ED50 for this effect is <10 μg/mL.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear