Mini Cart

IL-19, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01024 Category: Tags: , ,

Description

Interleukin 19 (IL-19) is a protein that in humans is encoded by the IL19 gene. This cytokine is found to be preferentially expressed in monocytes. It can bind the interleukin-20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively, spliced transcript variants encoding the distinct isoforms have been described.

Sequence: 
MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta.
The ED50 for this effect is <1.2 ng/mL.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear