Mini Cart

IFN omega, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01081 Category: Tags: , ,

Description

IFN-ω is a member of the type I interferon family, that can be induced by virus infected leukocytes and exert antiviral and anti-proliferative activities. IFN-ω shares about 75% sequence homology with IFN-α. There are two conserved disulfide bonds that are necessary for full biological activity.

Sequence: 
MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGL
HQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is <0.02 ng/mL. The specific activity of recombinant human IFN omega is approximately >5 x107 IU/mg.

Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear