Mini Cart

Galectin-16, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01167 Category: Tags: , ,

Description

There are 16 human galectin genes are expressed at the maternal-fetal interface and demonstrate that a cluster of 5 galectin genes. Three of the human cluster genes (LGALS13, -14, and -16) were found to be placenta-specific. Galectin-16 is found in primates. It is a placenta-specific galectin that induces the apoptosis of T lymphocytes, which may reduce the danger of maternal immune attacks on the fetal semi-allograft during the long gestation of anthropoid primates.

Sequence:
SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVC
LNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR with polyhistidine tag at the Nterminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear