Mini Cart

BMP-8a, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01068 Category: Tags: , ,

Description

Bone morphogenetic protein 8A (BMP8A) is a polypeptide member of the TGFβ superfamily of proteins. Like other BMPs, BMP8A is involved in the development of bone and cartilage. BMP8A may be involved in epithelial osteogenesis. It also plays a role in bone homeostasis. Human BMP‑8a is synthesized as a large precursor protein that is cleaved at a dibasic cleavage site (RTPR) between aa residues 263 and 264 to release a 139 aa carboxy‑terminal domain.

Sequence: 
MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQS
LVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 10-19.4 ng/mL.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear