Menu

Mini Cart

BMP-12, Human

96.00 USD475.20 USD

volume

Clear
SKU: C01073 Category: Tags: , ,

Description

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. BMP-12 regulates chondrogenesis, bone morphogenesis, and neuron differentiation.

Sequence: 
MTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAA
PASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <112 ng/mL.

Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.



Additional information

volume

5 μg, 20 μg, 100 µg

volume

Clear