Mini Cart

Croyez GMP® IL-7, Human

1,280.00 USD5,600.00 USD

volume

Clear
SKU: C01009 Category: Tag:

Description

Interleukin-7 (IL-7) is a protein that in humans is encoded by the IL7 gene. IL-7 stimulates the differentiation of multipotent (pluripotent) hematopoietic stem cells into lymphoid progenitor cells. It is important for proliferation during certain stages of B-cell maturation, T and NK cell survival, development and homeostasis.

Sequence:
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLN
CTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC).
The ED50 for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 7 x 108 IU/mg.

Purity:
>95% as determined by SDS-PAGE. Purified by Ni-NTA chromatography.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note:
Please use within one month after protein reconstitution.

Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Reference:
1. Lin J. et al. (2017) Anticancer Res. 37,3: 963-967.
2. Lundström W. et al. (2012) Semin Immunol. 24,3: 218-24.
3. Ceredig R, Rolink AG (2012). Semin Immunol. 24,3: 159‐64.
4. Jiang Q. et al. (2005) Cytokine Growth Factor Rev.16,4-5: 513-33.

Additional information

volume

1 mg, 100 µg

volume

Clear