Mini Cart

Croyez GMP® IFN gamma, Human

520.00 USD2,200.00 USD

volume

Clear
SKU: C01080 Category: Tag:

Description

Interferon gamma (IFN gamma) is an effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN gamma is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN gamma can upregulate expression of MHC class I and II antigen by antigen-presenting cells.

Sequence:
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDD
FEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus

Source:
Escherichia coli
Animal-free reagent and laboratory
Manufactured and tested under GMP guideline

Endotoxin level:
<0.01 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <1 ng/mL.
The specific activity of recombinant human IFN gamma is approximately >1 x 107 IU/mg.

Purity:
>95% as determined by SDS-PAGE. Purified by Ni-NTA chromatography.

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note:
Please use within one month after protein reconstitution.

Specification:
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Reference:
1. Schroder K. et al. (2004) J Leukoc Biol. 75,2: 163-89.
2. Schoenborn JR, Wilson CB. (2007) Adv Immunol. 96: 41-101.
3. Boehm U. et al. (1997) Annu Rev Immunol. 15: 749-95.
4. Ijzermans JN, Marquet RL. (1989) Immunobiology. 179,4-5: 456-73.
5. Razaghi A. et al. (2016) J Biotechnol. 240: 48-60.



Additional information

volume

1 mg, 100 µg

volume

Clear